Products

beta-NGF (Nerve growth factor-beta),Human

Nerve growth factor (NGF) is a neurotrophic factor and neuropeptide primarily involved in the regulation of growth, maintenance, proliferation, and survival of certain target neurons. NGF-β acts through its receptor β-NGFR and is involved in the development and maintenance of the sensory and sympathetic nervous systems. NGF-β also is also involved in the growth, differentiation, and survival of B lymphocytes. Human, mouse and rat proteins show cross-reactivity.

✔️ Highly bioactive and stable
✔️ Wide range of applications, including cell culture, in vivo studies, and biochemical assays

 
No. Size Price Qty Status
C01154-20UG 20 ug $100.00 Inquiry
C01154-100UG 100 ug $195.00 Inquiry
The price does not include shipping fee and tax. Order Request Quote
Sequence
MSSSHPIFHRGEFSVCDSVSVWVGDKTTATDIKGKEVMVLGEVNINNSVFKQYFFETKCRDPNPVDSGCRGIDSKHWNSYCTTTHTFVKAL
TMDGKQAAWRFIRIDTACVCVLSRKAVRRA with polyhistidine tag at the C-terminus

UnitProt ID:
P01138
 
Source
Escherichia coli

Endotoxin Test
<0.1 EU per 1 μg of the protein by the LAL method.

Activity
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <0.7 ng/mL.
The specific activity of recombinant human beta-NGF is > 1 x 106 IU/mg.
 
Purity:
>95% as determined by SDS-PAGE analysis.

Form:
Lyophilized

Storage Buffer:
Lyophilized from a 0.2 µm filtered solution containing 20 mM sodium citrate and 0.2 M NaCl, pH 3.5.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 200 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Stability & Storage​:
This product is stable after storage at:
• -20°C for 12 months in lyophilized state from date of receipt.
• -20°C or -80°C for 1 month under sterile conditions after reconstitution.
Avoid repeated freeze/thaw cycles.

Shipping Conditions:
Blue ice
Reviews for beta-NGF (Nerve growth factor-beta),Human

Average Rating: 0 (0 Reviews )